PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc06_g12870
Common NameGSCOC_T00041481001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family HD-ZIP
Protein Properties Length: 211aa    MW: 23049 Da    PI: 9.8705
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc06_g12870genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox634.3e-2055109256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++keq+ +Le+ F+k+ +++++++ eLA++lgL+ rqV vWFqNrRa+ k
  Cc06_g12870  55 RKKLRLSKEQTAVLEDSFKKHTTLNTAQKIELAARLGLKPRQVEVWFQNRRARTK 109
                  788899***********************************************98 PP

2HD-ZIP_I/II116.91.1e-3755144191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq ++LE+sF+++++L++ +K ela +Lgl+prqv+vWFqnrRARtk+kq+E+d+e  k+++d+l+een +L+ke ++L+ +l
  Cc06_g12870  55 RKKLRLSKEQTAVLEDSFKKHTTLNTAQKIELAARLGLKPRQVEVWFQNRRARTKLKQTETDCELWKNHCDNLREENGKLKKEIDDLK-AL 144
                  69************************************************************************************99.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-2040105IPR009057Homeodomain-like
SuperFamilySSF466897.94E-2043112IPR009057Homeodomain-like
PROSITE profilePS5007117.44351111IPR001356Homeobox domain
SMARTSM003895.8E-1853115IPR001356Homeobox domain
PfamPF000462.2E-1755109IPR001356Homeobox domain
CDDcd000863.66E-1855112No hitNo description
PRINTSPR000311.5E-68291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000311.5E-691107IPR000047Helix-turn-helix motif
PfamPF021832.6E-7111144IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.0E-10111154IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MVDDDFCNTK LALGIGTSSG NSVPKPDKRA LSLDLSLVDE GQSSRNSEDN GGESRKKLRL  60
SKEQTAVLED SFKKHTTLNT AQKIELAARL GLKPRQVEVW FQNRRARTKL KQTETDCELW  120
KNHCDNLREE NGKLKKEIDD LKALRAAFYA QITNCVGISV CPSCKKVQGV ATKGSSSGDG  180
KHERNATAAA ASGDVVQSPK YKHSGFKIRG *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15359SRKKLRL
2103111RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015896650.15e-50PREDICTED: homeobox-leucine zipper protein HAT4-like
TrEMBLA0A068U3D21e-155A0A068U3D2_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000325464e-49(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-48homeobox from Arabidopsis thaliana